PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_1751C4BBF.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 253aa    MW: 28001.1 Da    PI: 4.5705
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_1751C4BBF.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.41e-22119240290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk..................................tekerrtr 55 
                             Yn+YA ++GF +++++s+k  ++g  +k++fvC+k  k+e ++                                    ++k+r++ 
  Traes_1AS_1751C4BBF.2 119 HYNAYALQIGFPIKMNTSRKAVKTGVLIKQQFVCNKFRKPEADDGGaekipvlddiveqtkdddededivfldddnktkkRSKKRKRD 206
                            6************************************99999988899****************************999888888899 PP

                   FAR1  56 aetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                            +  +tgCkak++vk+  dg+wev+ ++ eHnH+l+
  Traes_1AS_1751C4BBF.2 207 KIVQTGCKAKMVVKLI-DGRWEVIYFVGEHNHPLV 240
                            999*************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-20119240IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MIDLNEEPDD MDIGDPVNST QQAAQNPELT GDSPTPHIVQ NATAPVAKTV ETDEQAPAAQ  60
ESETDGHTLD GTDVAGDTSV TVGNGLTGFG AENDEEAWSQ PKEPHVGMRF DTLEGAKEHY  120
NAYALQIGFP IKMNTSRKAV KTGVLIKQQF VCNKFRKPEA DDGGAEKIPV LDDIVEQTKD  180
DDEDEDIVFL DDDNKTKKRS KKRKRDKIVQ TGCKAKMVVK LIDGRWEVIY FVGEHNHPLV  240
DKPSLTKYLR SHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229542.14e-53PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_014756032.18e-54PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like
TrEMBLW4ZV000.0W4ZV00_WHEAT; Uncharacterized protein
STRINGMLOC_28634.11e-111(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-15FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]